Quanto è utile/interessante questa discussione:
| Autore |
Discussione |
|
|
mastrascia
Nuovo Arrivato
20 Messaggi |
 Inserito il - 27 marzo 2006 : 13:40:10
|
I have this aminoacids sequence of the protein:
MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAYEFNAAAAANA
QVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQLSPFLQPHGQQVPYYLENEPSGYT
VREAGPPAFYRPNSDNRRQGGRERLASTNDKGSMAMESAKETRYCAVCNDYASGYHYGVWSCEGCKAFFK
RSIQGHNDYMCPATNQCTIDKNRRKSCQACRLRKCYEVGMMKGGIRKDRRGGRMLKHKRQRDDGEGRGEV
GSAGDMRAANLWPSPLMIKRSKKNSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLA
DRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEG
MVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLM
AKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLLLEMLDAHRLHAPTSRGGASV
EETDQSHLATAGSTSSHSLQKYYITGEAEGFPATV
Now, I would of course like to know some more about the protein.
* The protein binds estrogen, also known as estradiol:
o What kind of protein is it?
o Gather as much information about its structure as you can.
o Find molecular details about how the binding of estradiol happens.
(The residues comprising the active site (the amino acids that are important for binding the ligand).
o In which tissues are the protein predominantly expressed?
+ What other proteins have a similar expression profile (Hint: Gene sorter in the UCSC browser)
I also want to see if the miRNA could regulate this specific protein. (miRNAs are thought to regulate mRNAs by partial base pairing to the 3' UTR of the mRNA.)
* To look for a target site of the miRNA in the mRNA for the protein, do the following:
o Find the mRNA sequence.
o Check if the miRNA can hybridise to the mRNA? How many base pairs can be formed?
I had problems to solve these problems...
Can someone help me?
Thank you
|
|
|
|
|
Ra1D
Utente Junior
Prov.: Bergamo
Città: Treviglio
174 Messaggi |
Inserito il - 27 marzo 2006 : 15:34:59
|
I don't know where you took this sequence, if you have downloaded it or else, however you can analyze an unknown sequence doing a comparison with fasta or blast against a protein data bank. I've done it with this sequence and resulted that is the human estrogen receptor.
You can find many informations at this link
http://www.ebi.uniprot.org/entry/ESR1_HUMAN
Take a look, i think that you can answer many of your question...
About estradiol http://en.wikipedia.org/wiki/Estradiol
You can search in the RCSB Protein Data Bank the code 1ERE, which is HUMAN ESTROGEN RECEPTOR LIGAND-BINDING DOMAIN IN COMPLEX WITH 17BETA-ESTRADIOL, and you can analyze it with some visualization program for pdb files like Swiss-PdbViewer. The aa of the active site are Glu53, Arg94, His224 if i remember correctly.
Bye
|
...e vicinissimo al mio sapere si accampa la tenebra della mia ignoranza... |
 |
|
|
kORdA
Utente Attivo
Prov.: Milano
Città: Monza
1303 Messaggi |
|
|
dallolio_gm
Moderatore
Prov.: Bo!
Città: Barcelona/Bologna
2445 Messaggi |
Inserito il - 27 marzo 2006 : 17:36:20
|
Citazione:
I had problems to solve these problems...
Can someone help me?
Thank you
Ehi gli altri due messaggi li hai scritti in italiano! Che lingua parli? ;) |
Il mio blog di bioinformatics (inglese): BioinfoBlog
Sono un po' lento a rispondere, posso tardare anche qualche giorno... ma abbiate fede! :-) |
|
|
|
mastrascia
Nuovo Arrivato
20 Messaggi |
Inserito il - 27 marzo 2006 : 18:12:31
|
Of course,
I'm an italian student... but until the end of june I'll be an erasmus student, and so until that time I'll speak in english...
capito perchè?
Thank you so much for the informations to Ra1D and kORdA...
see you
|
|
|
|
mastrascia
Nuovo Arrivato
20 Messaggi |
Inserito il - 27 marzo 2006 : 19:34:17
|
I tried to use RCSB, but it found different kind of proteins...why do you choise 1ERE?
and in wich tissues is the protein expressed?
Thank you |
|
|
|
mastrascia
Nuovo Arrivato
20 Messaggi |
Inserito il - 27 marzo 2006 : 21:01:07
|
Allora questa è la traccia completa del problema:
Newly cloned and sequenced miRNAs
You and your co-workers have been working hard in the lab, and the result is a collection of newly sequenced orthologous RNAs from a range of different species. The sequences:
>hsa-mir-22_MI0000078
GGCUGAGCCGCAGUAGUUCUUCAGUGGCAAGCUUUAUGUCCUGACCCAGCUAAAGCUGCCAGUUGAAGAACUGUUGCCCUCUGCC
>mmu-mir-22_MI0000570
ACCUGGCUGAGCCGCAGUAGUUCUUCAGUGGCAAGCUUUAUGUCCUGACCCAGCUAAAGCUGCCAGUUGAAGAACUGUUGCCCUCUGCCCCUGGC
>rno-mir-22_MI0000851
ACCUGGCUGAGCCGCAGUAGUUCUUCAGUGGCAAGCUUUAUGUCCUGACCCAGCUAAAGCUGCCAGUUGAAGAACUGUUGCCCUCUGCCACUGGC
>dre-mir-22a-1_MI0001910
GCUGACCUGCAGCAGUUCUUCACUGGCAAGCUUUAUGUCCUUGUGUACCAGCUAAAGCUGCCAGCUGAAGAACUGUUGUGGUUGGC
>dre-mir-22a-2_MI0001911
GCUGACCUGCAGCAGUUCUUCACUGGCAAGCUUUAUGUCCUUGUGUACCAGCUAAAGCUGCCAGCUGAAGAACUGUUGUGGUUGGC
>dre-mir-22b_MI0001912
GUUACUUCACAGUCGUUCUUCACUGGCUAGCUUUAUGUGGCAGCACCUUAAAGCUGCCAGUUGAAGAGCUGUUGUGGGUAAC
>age-mir-22_MI0002628
GGCUGAGCCGCAGUAGUUCUUCAGUGGCAAGCUUUAUGUCCUGACCCAGCUAAAGCUGCCAGUUGAAGAACUGUUGCCCUCUGCC
>ppa-mir-22_MI0002629
GGCUGAGCCGCAGUAGUUCUUCAGUGGCAAGCUUUAUGUCCUGACCCAGCUAAAGCUGCCAGUUGAAGAACUGUUGCCCUCUGCC
>lca-mir-22_MI0002630
GGCUGAGCCGCAGUAGUUCUUCAGUGGCAAGCUUUAUGUCCUGACCCAGCUAAAGCUGCCAGUUGAAGAACUGUUGCCCUCUGCC
>mml-mir-22_MI0002631
GGCUGAGCCGCAGUAGUUCUUCAGUGGCAAGCUUUAUGUCCUGACCCAGCUAAAGCUGCCAGUUGAAGAACUGUUGCCCUCUGCC
>ppy-mir-22_MI0002632
GGCUGAGCCGCAGUAGUUCUUCAGUGGCAAGCUUUAUGUCCUGACCCAGCUAAAGCUGCCAGUUGAAGAACUGUUGCCCUCUGCC
>ptr-mir-22_MI0002633
GGCUGAGCCGCAGUAGUUCUUCAGUGGCAAGCUUUAUGUCCUGACCCAGCUAAAGCUGCCAGUUGAAGAACUGUUGCCCUCUGCC
>sla-mir-22_MI0002634
GGCUGAGCCGCAGUAGUUCUUCAGUGGCAAGCUUUAUGUCCUGACCCCGCUAAAGCUGCCAGUUGAAGAACUGUUGCCCUCUGCC
>lla-mir-22_MI0002635
GGCUGAGCCGCAGUAGUUCUUCAGUGGCAAGCUUUAUGUCCUGACCCAGCUAAAGCUGCCAGUUGAAGAACUGUUGCCCUCUGCC
>mne-mir-22_MI0002636
GGCUGAGCCGCAGUAGUUCUUCAGUGGCAAGCUUUAUGUCCUGACCCAGCUAAAGCUGCCAGUUGAAGAACUGUUGCCCUCUGCC
>fru-mir-22b_MI0003381
GUUGCCUCACAGUCGUUCUUCACUGGCUAGCUUUAUGUCCUCUGACCCAUGCUAAAGCUGCCAGUUGAAGAGCUGUUGUGUGUAAC
>tni-mir-22b_MI0003382
GUUGCCUCACAGUCGUUCUUCACUGGCUAGCUUUAUGUCCUCCGACCCCACGCUAAAGCUGCCAGUUGAAGAGCUGUUGUGUGUAAC
>fru-mir-22a_MI0003463
GCCGACCUACAGCAGUUCUUCACUGGCAAGCUUUAUGUCCUCGUGCAACAGCUAAAGCUGCCAGCUGAAGAACUGUUGUGGUUGGC
>tni-mir-22a_MI0003464
GCCGACCUACAGCAGUUCUUCACUGGCAAGCUUUAUGUCCUCGUGCAACCGCUAAAGCUGCCAGCUGAAGAACUGUUGUGGUCGGC
Of course, you would now like to find out what kind of sequences they are. You have an idea that it is a family of microRNAs (miRNA), but you will have to test that. A mature miRNA is about 20 nucleotides long, so these are probably the miRNA precursors (pre-miRNA).
1)Examine whether the sequences could be pre-miRNA:
2)Look at the conservation of a multiple alignment of the RNAs. Are some parts more conserved than others?
3) Investigate whether the sequences can fold into the distinctive hairpin structure of pre-miRNAs.
The functional part is the shorter, mature miRNA of approximately 20 nucleotides. You need to determine this sequence to do further investigations. In the following, focus on the human RNA sequence called hsa-mir-22.
4) Determine the sequence of the mature human miRNA using online annotation databases.
5) How does the mature sequence correspond to the conservation seen in the multiple alignment?
A possible target
Now you are confident that it is a family of miRNAs, and you continue to focus on the human sequence. The next interesting step would be to find possible targets that it can regulate. After doing extensive laboratory studies and reading hundreds of papers, you discover an interesting coexpression pattern between the miRNA and a specific protein. Here is the amino acid sequence of the protein:
MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAYEFNAAAAANA
QVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQLSPFLQPHGQQVPYYLENEPSGYT
VREAGPPAFYRPNSDNRRQGGRERLASTNDKGSMAMESAKETRYCAVCNDYASGYHYGVWSCEGCKAFFK
RSIQGHNDYMCPATNQCTIDKNRRKSCQACRLRKCYEVGMMKGGIRKDRRGGRMLKHKRQRDDGEGRGEV
GSAGDMRAANLWPSPLMIKRSKKNSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLA
DRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEG
MVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLM
AKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLLLEMLDAHRLHAPTSRGGASV
EETDQSHLATAGSTSSHSLQKYYITGEAEGFPATV
Now, you would of course like to know some more about the protein. Therefore, you quickly turn to the Internet to gather some additional information.
1)The protein binds estrogen, also known as estradiol:
2) What kind of protein is it?
3)Gather as much information about its structure as you can.
4) Find molecular details about how the binding of estradiol happens.
Note the residues comprising the active site (the amino acids that are important for binding the ligand).
5) In which tissues are the protein predominantly expressed?
6) What other proteins have a similar expression profile (Hint: Gene sorter in the UCSC browser)
You now want to see if the miRNA could regulate this specific protein. Recall that miRNAs are thought to regulate mRNAs by partial base pairing to the 3' UTR of the mRNA.
7) To look for a target site of the miRNA in the mRNA for the protein, do the following:
8) Find the mRNA sequence.
9) Check if the miRNA can hybridise to the mRNA? How many base pairs can be formed?
Conservation and phylogeny of the target protein
You are now almost convinced that there is a connection between the miRNA and the protein under consideration. To further investigate, you decide to do some evolutionary studies. For this, you need some homologous proteins.
1) Collect a dataset of 10-15 highly similar proteins from other organisms by searching through Swissprot.
You now have a dataset consisting of a number of homologous sequences, all from different species.
2)From which species are your sequences?
* 3)Make a multiple alignment.
o4) Are the sequences well conserved?
o 5)Do some sequences stand out?
o 6)Previously you found the amino acids involved in binding estradiol (the active site). Examine the conservation of the amino acids in the active site of the protein that you found.
To get some additional information, you decide to perform a phylogenetic analysis of the dataset.
* 7)Make a phylogenetic tree of the proteins:
o 8)Use at least three different methods, at least one of which uses confidence testing of the branches.
o 9)Do the trees agree on the phylogeny?
o10) Does your phylogeny match the traditional phylogeny of the species?
Expressional changes upon stimulation with ligand
Estrogen treatment of postmenupausal women has many beneficial effects, but it has also been associated with an increased incidence of breast cancer. In order to examine the effect of estrogen treatment on breast tissue an expression study has been carried out. The experiment is designed to measure changes in gene expression in a breast cell line due to the presence (or absence) of estrogen and due to a time effect (10 hours or 48 hours).
* Download the dataset here
* Check the arrays and exclude arrays with gross artefacts if any (hint: Use the "Array list file"-function in the Tools menu, or simply delete the CEL-files for any arrays with big artefacts).
* Make all the standard normalization and modelling in dChip.
* Investigate whether any genes are upregulated in the high estrogen concentration samples:
o Compare cells incubated with high vs low estrogen concentration. Choose reasonable conservative cutoffs in order to get around 200-300 genes.
o Are any functional groups significantly upregulated in the high estrogen experiments?
o Does this make biological sense?
Thank you for your availability
|
|
|
|
dallolio_gm
Moderatore
Prov.: Bo!
Città: Barcelona/Bologna
2445 Messaggi |
Inserito il - 27 marzo 2006 : 23:16:22
|
Appero'!! Niente male 
Per curiosita', com'è studiare all'estero? Fate molta bioinformatica?
Citazione:
1)Examine whether the sequences could be pre-miRNA:
2)Look at the conservation of a multiple alignment of the RNAs. Are some parts more conserved than others?
3) Investigate whether the sequences can fold into the distinctive hairpin structure of pre-miRNAs.
Per prima cosa devi trovare un database di sequenze di miRNA. Presumo che tu l'abbia gia' fatto, in ogni caso un buon punto da cui partire (a parte cercare su google) puo' essere questa directory: www.net/browse-120.html" target="_blank" rel="nofollow">biowww.
C'è appunto un database di miRNA, http://microrna.sanger.ac.uk/sequences/index.shtml.
Visto che il motore di ricerca messo a disposizione su quel sito e' piuttosto scomodo (permette di fare analisi su una sequenza alla volta), conviene scaricarsi tutto il database in formato testo sul proprio computer.
Se vai nella loro sezione download, ci sono due files che ti interessano, quello per gli miRNA maturi, e quello per le seq. che formano hairpin.
Ora che hai i due files delle sequenze non ti rimane che allinearli... io uso exonerate, un piccolo tool da riga di comando.
Io do una query tipo questa:
[/bin/bash]$: exonerate -q miRNAs.fasta -t mature.fa -n 1"|less
e mi escono fuori dei risultati come questo:
C4 Alignment:
------------
Query: age-mir-22_MI0002628
Target: rno-miR-22* MIMAT0003152 Rattus norvegicus miR-22*
Model: ungapped:simple
Raw score: 154
Query range: 14 -> 35
Target range: 0 -> 21
15 : AGUUCUUCAGUGGCAAGCUUU : 35
|||||||||||||||||||||
1 : AGUUCUUCAGUGGCAAGCUUU : 21
vulgar: age-mir-22_MI0002628 14 35 . rno-miR-22* 0 21 . 154 M 21 21
C4 Alignment:
------------
Query: dre-mir-22a-1_MI0001910
Target: hsa-miR-22 MIMAT0000077 Homo sapiens miR-22
Model: ungapped:simple
Raw score: 145
Query range: 54 -> 76
Target range: 0 -> 22
55 : AAGCUGCCAGCUGAAGAACUGU : 76
||||||||||:|||||||||||
1 : AAGCUGCCAGUUGAAGAACUGU : 22
vulgar: dre-mir-22a-1_MI0001910 54 76 . hsa-miR-22 0 22 . 145 M 22 22
In questo esempio, una delle sequenze (ge-mir-22_MI0002628) si allinea perfettamente con un miRNA del database, rno-miR-22*.
Invece nel secondo caso, se guardi bene, c'è un gap (piu' o meno la decima posizione), quindi quella seq. non e' un miRNA.
Giocando un po' con le opzioni (--ryo) di exonerate e con un po' di comandi da shell, ti puoi ricavare una tabella che metta in relazione le seq. che hai in mano con quelle nel dtb, tipo questa:
[/bin/bash]$: exonerate -q miRNAs.fasta -t mature.fa -n 1 --ryo "\n- %qi : %ti : %em\n"|grep "\- " |gawk '$6 ~/0/ {print $0}'|sort -u -k 2
- age-mir-22_MI0002628 : rno-miR-22* : 0
- dre-mir-22a-1_MI0001910 : dre-miR-22a : 0
- dre-mir-22a-1_MI0001910 : fru-miR-22a : 0
- dre-mir-22a-1_MI0001910 : tni-miR-22a : 0
- dre-mir-22a-2_MI0001911 : dre-miR-22a : 0
- dre-mir-22a-2_MI0001911 : fru-miR-22a : 0
- dre-mir-22a-2_MI0001911 : tni-miR-22a : 0
- dre-mir-22b_MI0001912 : dre-miR-22b : 0
- dre-mir-22b_MI0001912 : fru-miR-22b : 0
- dre-mir-22b_MI0001912 : tni-miR-22b : 0
- fru-mir-22a_MI0003463 : dre-miR-22a : 0
- fru-mir-22a_MI0003463 : fru-miR-22a : 0
- fru-mir-22a_MI0003463 : tni-miR-22a : 0
- fru-mir-22b_MI0003381 : dre-miR-22b : 0
- fru-mir-22b_MI0003381 : fru-miR-22b : 0
- fru-mir-22b_MI0003381 : tni-miR-22b : 0
- hsa-mir-22_MI0000078 : rno-miR-22* : 0
- lca-mir-22_MI0002630 : rno-miR-22* : 0
- lla-mir-22_MI0002635 : rno-miR-22* : 0
- mml-mir-22_MI0002631 : rno-miR-22* : 0
- mmu-mir-22_MI0000570 : rno-miR-22* : 0
- mne-mir-22_MI0002636 : rno-miR-22* : 0
- ppa-mir-22_MI0002629 : rno-miR-22* : 0
- ppy-mir-22_MI0002632 : rno-miR-22* : 0
- ptr-mir-22_MI0002633 : rno-miR-22* : 0
- rno-mir-22_MI0000851 : rno-miR-22* : 0
- sla-mir-22_MI0002634 : rno-miR-22* : 0
- tni-mir-22a_MI0003464 : dre-miR-22a : 0
- tni-mir-22a_MI0003464 : fru-miR-22a : 0
- tni-mir-22a_MI0003464 : tni-miR-22a : 0
- tni-mir-22b_MI0003382 : dre-miR-22b : 0
- tni-mir-22b_MI0003382 : fru-miR-22b : 0
- tni-mir-22b_MI0003382 : tni-miR-22b : 0
-> qui ti ho messo nella prima colonna l'RNA tra le tue sequenze, nella seconda l'miRNA del database corrispondente e nella terza, il numero di gaps (stampando solo quelli in cui sono 0).
Per gli hairpin invece, potresti pensare ad un metodo di predizione piu' accurato, ma cmq se provi l'allineamento trovi cmq dei risultati soddisfacenti:
- age-mir-22_MI0002628 : age-mir-22 : 0, 85
- age-mir-22_MI0002628 : hsa-mir-22 : 0, 85
- age-mir-22_MI0002628 : lca-mir-22 : 0, 85
- age-mir-22_MI0002628 : lla-mir-22 : 0, 85
- age-mir-22_MI0002628 : mml-mir-22 : 0, 85
- age-mir-22_MI0002628 : mmu-mir-22 : 0, 85
- age-mir-22_MI0002628 : mne-mir-22 : 0, 85
- age-mir-22_MI0002628 : ppa-mir-22 : 0, 85
- age-mir-22_MI0002628 : ppy-mir-22 : 0, 85
- age-mir-22_MI0002628 : ptr-mir-22 : 0, 85
- age-mir-22_MI0002628 : rno-mir-22 : 0, 85
- dre-mir-22a-1_MI0001910 : dre-mir-22a-1 : 0, 86
- dre-mir-22a-1_MI0001910 : dre-mir-22a-2 : 0, 86
- dre-mir-22a-2_MI0001911 : dre-mir-22a-1 : 0, 86
- dre-mir-22a-2_MI0001911 : dre-mir-22a-2 : 0, 86
- dre-mir-22b_MI0001912 : dre-mir-22b : 0, 82
- fru-mir-22a_MI0003463 : fru-mir-22a : 0, 86
- fru-mir-22b_MI0003381 : fru-mir-22b : 0, 86
- hsa-mir-22_MI0000078 : age-mir-22 : 0, 85
- hsa-mir-22_MI0000078 : hsa-mir-22 : 0, 85
- hsa-mir-22_MI0000078 : lca-mir-22 : 0, 85
- hsa-mir-22_MI0000078 : lla-mir-22 : 0, 85
- hsa-mir-22_MI0000078 : mml-mir-22 : 0, 85
- hsa-mir-22_MI0000078 : mmu-mir-22 : 0, 85
- hsa-mir-22_MI0000078 : mne-mir-22 : 0, 85
- hsa-mir-22_MI0000078 : ppa-mir-22 : 0, 85
- hsa-mir-22_MI0000078 : ppy-mir-22 : 0, 85
- hsa-mir-22_MI0000078 : ptr-mir-22 : 0, 85
- hsa-mir-22_MI0000078 : rno-mir-22 : 0, 85
- lca-mir-22_MI0002630 : age-mir-22 : 0, 85
- lca-mir-22_MI0002630 : hsa-mir-22 : 0, 85
- lca-mir-22_MI0002630 : lca-mir-22 : 0, 85
- lca-mir-22_MI0002630 : lla-mir-22 : 0, 85
- lca-mir-22_MI0002630 : mml-mir-22 : 0, 85
- lca-mir-22_MI0002630 : mmu-mir-22 : 0, 85
- lca-mir-22_MI0002630 : mne-mir-22 : 0, 85
- lca-mir-22_MI0002630 : ppa-mir-22 : 0, 85
- lca-mir-22_MI0002630 : ppy-mir-22 : 0, 85
- lca-mir-22_MI0002630 : ptr-mir-22 : 0, 85
- lca-mir-22_MI0002630 : rno-mir-22 : 0, 85
- lla-mir-22_MI0002635 : age-mir-22 : 0, 85
- lla-mir-22_MI0002635 : hsa-mir-22 : 0, 85
- lla-mir-22_MI0002635 : lca-mir-22 : 0, 85
- lla-mir-22_MI0002635 : lla-mir-22 : 0, 85
- lla-mir-22_MI0002635 : mml-mir-22 : 0, 85
- lla-mir-22_MI0002635 : mmu-mir-22 : 0, 85
- lla-mir-22_MI0002635 : mne-mir-22 : 0, 85
- lla-mir-22_MI0002635 : ppa-mir-22 : 0, 85
- lla-mir-22_MI0002635 : ppy-mir-22 : 0, 85
- lla-mir-22_MI0002635 : ptr-mir-22 : 0, 85
- lla-mir-22_MI0002635 : rno-mir-22 : 0, 85
- mml-mir-22_MI0002631 : age-mir-22 : 0, 85
- mml-mir-22_MI0002631 : hsa-mir-22 : 0, 85
- mml-mir-22_MI0002631 : lca-mir-22 : 0, 85
- mml-mir-22_MI0002631 : lla-mir-22 : 0, 85
- mml-mir-22_MI0002631 : mml-mir-22 : 0, 85
- mml-mir-22_MI0002631 : mmu-mir-22 : 0, 85
- mml-mir-22_MI0002631 : mne-mir-22 : 0, 85
- mml-mir-22_MI0002631 : ppa-mir-22 : 0, 85
- mml-mir-22_MI0002631 : ppy-mir-22 : 0, 85
- mml-mir-22_MI0002631 : ptr-mir-22 : 0, 85
- mml-mir-22_MI0002631 : rno-mir-22 : 0, 85
- mmu-mir-22_MI0000570 : mmu-mir-22 : 0, 95
- mne-mir-22_MI0002636 : age-mir-22 : 0, 85
- mne-mir-22_MI0002636 : hsa-mir-22 : 0, 85
- mne-mir-22_MI0002636 : lca-mir-22 : 0, 85
- mne-mir-22_MI0002636 : lla-mir-22 : 0, 85
- mne-mir-22_MI0002636 : mml-mir-22 : 0, 85
- mne-mir-22_MI0002636 : mmu-mir-22 : 0, 85
- mne-mir-22_MI0002636 : mne-mir-22 : 0, 85
- mne-mir-22_MI0002636 : ppa-mir-22 : 0, 85
- mne-mir-22_MI0002636 : ppy-mir-22 : 0, 85
- mne-mir-22_MI0002636 : ptr-mir-22 : 0, 85
- mne-mir-22_MI0002636 : rno-mir-22 : 0, 85
- ppa-mir-22_MI0002629 : age-mir-22 : 0, 85
- ppa-mir-22_MI0002629 : hsa-mir-22 : 0, 85
- ppa-mir-22_MI0002629 : lca-mir-22 : 0, 85
- ppa-mir-22_MI0002629 : lla-mir-22 : 0, 85
- ppa-mir-22_MI0002629 : mml-mir-22 : 0, 85
- ppa-mir-22_MI0002629 : mmu-mir-22 : 0, 85
- ppa-mir-22_MI0002629 : mne-mir-22 : 0, 85
- ppa-mir-22_MI0002629 : ppa-mir-22 : 0, 85
- ppa-mir-22_MI0002629 : ppy-mir-22 : 0, 85
- ppa-mir-22_MI0002629 : ptr-mir-22 : 0, 85
- ppa-mir-22_MI0002629 : rno-mir-22 : 0, 85
- ppy-mir-22_MI0002632 : age-mir-22 : 0, 85
- ppy-mir-22_MI0002632 : hsa-mir-22 : 0, 85
- ppy-mir-22_MI0002632 : lca-mir-22 : 0, 85
- ppy-mir-22_MI0002632 : lla-mir-22 : 0, 85
- ppy-mir-22_MI0002632 : mml-mir-22 : 0, 85
- ppy-mir-22_MI0002632 : mmu-mir-22 : 0, 85
- ppy-mir-22_MI0002632 : mne-mir-22 : 0, 85
- ppy-mir-22_MI0002632 : ppa-mir-22 : 0, 85
- ppy-mir-22_MI0002632 : ppy-mir-22 : 0, 85
- ppy-mir-22_MI0002632 : ptr-mir-22 : 0, 85
- ppy-mir-22_MI0002632 : rno-mir-22 : 0, 85
- ptr-mir-22_MI0002633 : age-mir-22 : 0, 85
- ptr-mir-22_MI0002633 : hsa-mir-22 : 0, 85
- ptr-mir-22_MI0002633 : lca-mir-22 : 0, 85
- ptr-mir-22_MI0002633 : lla-mir-22 : 0, 85
- ptr-mir-22_MI0002633 : mml-mir-22 : 0, 85
- ptr-mir-22_MI0002633 : mmu-mir-22 : 0, 85
- ptr-mir-22_MI0002633 : mne-mir-22 : 0, 85
- ptr-mir-22_MI0002633 : ppa-mir-22 : 0, 85
- ptr-mir-22_MI0002633 : ppy-mir-22 : 0, 85
- ptr-mir-22_MI0002633 : ptr-mir-22 : 0, 85
- ptr-mir-22_MI0002633 : rno-mir-22 : 0, 85
- rno-mir-22_MI0000851 : rno-mir-22 : 0, 95
- sla-mir-22_MI0002634 : sla-mir-22 : 0, 85
- tni-mir-22a_MI0003464 : tni-mir-22a : 0, 86
- tni-mir-22b_MI0003382 : tni-mir-22b : 0, 87
Forse potresti provare anche con qualche tool di previsione della strutt. secondaria dell'RNA, tipo questo:http://www.genebee.msu.su/services/rna2_reduced.html |
Il mio blog di bioinformatics (inglese): BioinfoBlog
Sono un po' lento a rispondere, posso tardare anche qualche giorno... ma abbiate fede! :-) |
|
|
|
dallolio_gm
Moderatore
Prov.: Bo!
Città: Barcelona/Bologna
2445 Messaggi |
Inserito il - 27 marzo 2006 : 23:32:14
|
Citazione:
B) A possible target
A questo ti hanno gia' risposto in parte.
Il primo passo e' di usare un tool di allineamento per vedere a quale proteina corrisponde la tua sequenza:
MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAYEFNAAAAANA
QVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQLSPFLQPHGQQVPYYLENEPSGYT
VREAGPPAFYRPNSDNRRQGGRERLASTNDKGSMAMESAKETRYCAVCNDYASGYHYGVWSCEGCKAFFK
RSIQGHNDYMCPATNQCTIDKNRRKSCQACRLRKCYEVGMMKGGIRKDRRGGRMLKHKRQRDDGEGRGEV
GSAGDMRAANLWPSPLMIKRSKKNSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLA
DRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEG
MVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLM
AKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLLLEMLDAHRLHAPTSRGGASV
EETDQSHLATAGSTSSHSLQKYYITGEAEGFPATV Devi anche decidere quale database usare per il confronto; l'ideale e' UNIPROTKB, che contiene le seq. meglio annotate. Vai su http://www.uniprot.org e cerca tra i tools di ricerca quello basato su blast: http://www.pir.uniprot.org/search/blast.shtml.
Quando farai la ricerca ti usciranno due risultati con lo stesso score, 100%: non c'è nessuna ragione di preferire una fra le due, quindi prendine una a caso.
Un'altra soluzione per fare la ricerca in maniera piu' veloce sarebbe stato lo sha1sum, ma dovresti aver avuto il dtb scaricato in locale.
Se inoltre il tool di blast di uniprot che ti ho segnalato sopra non funziona, provane un altro: http://br.expasy.org/cgi-bin/blast.pl, http://www.ch.embnet.org/software/aBLAST.html.
Una volta finito, hai un codice swiss-prot, tipo p03372. Ti basta accedere al record corrispondente su expasy per avere molte delle informazioni che hai chiesto: http://br.expasy.org/uniprot/P03372 .
Da qui inizia ad essere un po' difficile capire quello che l'esercizio ti chiede, perche' probabilmente si riferisce a qualcosa che avete fatto a lezione... cmq credo che siano piu' o meno tutte nel record di sp.
Per le strutture, vedi che ce no sono parecchie (tra l'altro nessuna e' completa); per avere una panoramica, prova qui: http://br.expasy.org/cgi-bin/view-pdb?src=P03372 .
In alternativa alla visualizzazione in 3d puoi ottenere delle informazioni sui domini, per esempio su PFam: http://www.sanger.ac.uk/cgi-bin/Pfam/swisspfamget.pl?name=P03372
Citazione:
8) Find the mRNA sequence.
9) Check if the miRNA can hybridise to the mRNA? How many base pairs can be formed?
Per l'mRNA, devi utilizzare il link a ensembl: http://www.ensembl.org/Homo_sapiens/geneview?gene=ENSG00000091831
In alternativa, potresti usare il genome browser di ucsc (http://genome.ucsc.edu), specificare il nome della proteina (http://genome.ucsc.edu/cgi-bin/pbGlobal?proteinID=P03372) ed ottenere l'mRNA tramite BLAT (un programma di allineamento simile a blast, ma piu' veloce per le seq. nucleotidiche): http://tinyurl.com/r4vmg .
Sempre da li' trovi il link a GeneSorter: http://genome.ucsc.edu/cgi-bin/hgNear?near_search=NM_000125&db=hg17&org=Human
|
Il mio blog di bioinformatics (inglese): BioinfoBlog
Sono un po' lento a rispondere, posso tardare anche qualche giorno... ma abbiate fede! :-) |
|
|
|
mastrascia
Nuovo Arrivato
20 Messaggi |
Inserito il - 29 marzo 2006 : 16:41:40
|
RAgazzi siete stati fantastici, senza di di voi sarei ancora in cattive acque...Per rispondere a te:  dallolio_gm 
qui nell università di Copenhagen si fa tantissima BIOINFORMATICA...pensa che il corso che ho seguito io si intitola INTRODUCTION to BIOINFORMATICS...ti rendi conto e ce ne sono almeno altri 3 di categoria superiore...
...altro che quello skifo di università italiana....
...cmq volevo chiderti un ultimo favore...lo so che già sono stato troppo invadente...
ma potresti aiutarmi sull ultimo punto...di quello non cho capito grankè, perchè dovrei utilizzare un programma...DNAchip che non so nemmeno avviare, pensa te...
Expressional changes upon stimulation with ligand
Estrogen treatment of postmenupausal women has many beneficial effects, but it has also been associated with an increased incidence of breast cancer. In order to examine the effect of estrogen treatment on breast tissue an expression study has been carried out. The experiment is designed to measure changes in gene expression in a breast cell line due to the presence (or absence) of estrogen and due to a time effect (10 hours or 48 hours).
* Download the dataset here http://www.binf.ku.dk/~stinus/zxycm/exam.zip
* Check the arrays and exclude arrays with gross artefacts if any (hint: Use the "Array list file"-function in the Tools menu, or simply delete the CEL-files for any arrays with big artefacts).
* Make all the standard normalization and modelling in dChip.
* Investigate whether any genes are upregulated in the high estrogen concentration samples:
o Compare cells incubated with high vs low estrogen concentration. Choose reasonable conservative cutoffs in order to get around 200-300 genes.
o Are any functional groups significantly upregulated in the high estrogen experiments?
o Does this make biological sense?
GRAZIE MILLE A TUTTI E BUONA SERATA...
mast
|
|
|
|
kORdA
Utente Attivo
Prov.: Milano
Città: Monza
1303 Messaggi |
|
|
mastrascia
Nuovo Arrivato
20 Messaggi |
Inserito il - 31 marzo 2006 : 10:49:16
|
ragazzi scusatemi,
potreste dirmi che differenza c'è tra un "Single outliers" e un "array outliers"...
praticamente sto usando il programma DNAchip e dopo la "model-based expression" mi si chiede di distinguere tra i due outliers...
analizzando l'immagine i SINGLE outliers appaiono come flashing dots (puntini lampeggianti) e gli ARRAY OUTLIERS come delle barrettine bianche...che significa tutto questo?
in più ci sono dei puntini viola (molto meno frequenti) e non capisco cosa diavolo siano... potreste darmi una mano?
grazie infinite...
Mast |
|
|
|
chick80
Moderatore
Città: Edinburgh
11491 Messaggi |
Inserito il - 31 marzo 2006 : 11:27:54
|
hmmm ho provato a cercare un po' su Internet per trovare qualche esempio/tutorial su DNAchip... ma non si trova nulla.
Il programma si chiama esattamente DNAchip? Che casa lo produce? Sembra non esistere! |
Sei un nuovo arrivato?
Leggi il regolamento del forum e presentati qui
My photo portfolio (now on G+!) |
|
|
|
mastrascia
Nuovo Arrivato
20 Messaggi |
Inserito il - 31 marzo 2006 : 12:04:43
|
allora il nome del programma è
dChip 2006 (DNA-Chip Analyzer)
www.dchip.org
(C)2006 Cheng Li Group
bha... |
|
|
|
chick80
Moderatore
Città: Edinburgh
11491 Messaggi |
Inserito il - 31 marzo 2006 : 14:12:46
|
Ok, allora non ho mai usato dChip, ne' un Affymetrix... comunque se non ho capito male:
single outliner e' un singolo spot del microarray in cui la probe non ibrida come dovrebbe per qualche motivo. Se pero' le altre probes per quel gene sono affidabili puoi compensare la perdita di quel dato. In qualunque microarray tu metta quella probe non si leghera' mai bene al target.
Gli array outliners invece derivano dal fatto che un certo set di probes del tuo microarray lega aspecificamente altre cose. Quindi e' un problema piu' vasto ma che puo' essere risolto usando un microarray che non contenga quelle probes.
Prendi queste info con le pinze, perche' come gia' detto non sono affatto un esperto in materia.
|
Sei un nuovo arrivato?
Leggi il regolamento del forum e presentati qui
My photo portfolio (now on G+!) |
|
|
|
mastrascia
Nuovo Arrivato
20 Messaggi |
Inserito il - 05 aprile 2006 : 18:26:51
|
grazie a tutti per la collaborazione...
finalmente ho consegnato il lavoro e domani dovrei avere l orale...
solo pero non ho capito una cosa...
dopo aver analizzato le sequenze con un programma di secondary structure prediction... ho come risultato questi grafici...come cavolo devo interpretarli se per caso mi domandano qualocosa a riguardo?
Immagine:
63,93 KB
Immagine:
58,3 KB
Immagine:
81,34 KB
Stessa cosa per questo phylogenitic tree delle preteine...
come interpretarlo?
Immagine:
67,82 KB
grazie a tutti
mast |
|
|
|
dallolio_gm
Moderatore
Prov.: Bo!
Città: Barcelona/Bologna
2445 Messaggi |
Inserito il - 11 aprile 2006 : 22:28:58
|
ciao!!
allora ti chiedo umilmente perdono per non aver risposto in tempo!!! Purtroppo anche io sono un po' sobbarcato di esami 
Ti vorrei chiedere un favore: giusto per correttezza del forum, potresti dirci come è andato l'esame? Più o meno qualche commento sugli esercizi che hai messo?
Per esempio, delle immagini che hai postato, la prima è un grafico che non conosco (cos'è?) e la seconda più o meno so come è ottenuta; la terza è un dotplot di una seq. invertita, mentre l'ultima è un allineamento multiplo il cui significato dipende un po' dai parametri che hai messo. anche io torno all'estero fra un po' (forse)!!! divertiti ma non dimenticare l'Italia!! |
Il mio blog di bioinformatics (inglese): BioinfoBlog
Sono un po' lento a rispondere, posso tardare anche qualche giorno... ma abbiate fede! :-) |
|
|
|
kORdA
Utente Attivo
Prov.: Milano
Città: Monza
1303 Messaggi |
Inserito il - 12 aprile 2006 : 10:49:37
|
| Cosi a naso (e basandomi su alcune review in cui ho visto grafici simili, ma relativi all'analisi del folding di proteine) credo che il dot-plot illustri quali coppie di base azotate contraggano legami idrogeno e quindi si appaiano. La colorazione dovrebbe indicare quanto l'appaiamento sia ottimale, in termini di distanze e angoli di legame... |
http://www.linkedin.com/in/dariocorrada |
|
|
| |
Discussione |
|
|
|
Quanto è utile/interessante questa discussione:
| MolecularLab.it |
© 2003-18 MolecularLab.it |
|
|
|
Possible Target
Guide tools online
non sono troppo convinto che nell'ultimo problema si parli di un software chiamato "DNAchip"...
